H00002547-M05

XRCC6 antibody from Abnova Corporation
D22S671, D22S731, G22P1, KU70, ML8

Antibody data

Product number
H00002547-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002547-M05, RRID:AB_1237908
Product name
XRCC6 monoclonal antibody (M05), clone 3D12
Provider product page
Abnova Corporation - H00002547-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant XRCC6.
Antigen sequence
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGR
DSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV
YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVL
QELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD
YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNP
HGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGG
FDISLFYRDTISIAEDEDLRVHFEESSKLEDLLRK
VRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKA
LKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSD
TKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF
KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSAL
LIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEEL
DDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMAT
PEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNL
EALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEF
KELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYS
EEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLK
KQELLEALTKHFQD
Isotype
IgG
Antibody clone number
3D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -