HPA020100

PLCG2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020100
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020100, RRID:AB_1855325
Product name
Anti-PLCG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020100
Antibody type
Polyclonal
Antigen
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLG
PRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRH
YCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFG
EKWFHKK
Storage
-20C
Provider Type Product Number
- No reagents -