Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309926 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Signal Transducer and Activator of Transcription 5B (STAT5B) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STAT5B antibody: synthetic peptide directed towards the C terminal of human STAT5B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDG
DFDLE DTMDVARRVE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Transcriptional activation of signal transducer and activator of transcription (STAT) 3 and STAT5B partially mediate homeobox A1-stimulated oncogenic transformation of the immortalized human mammary epithelial cell.
Mohankumar KM, Perry JK, Kannan N, Kohno K, Gluckman PD, Emerald BS, Lobie PE
Endocrinology 2008 May;149(5):2219-29
Endocrinology 2008 May;149(5):2219-29
No comments: Submit comment
No validations: Submit validation data