H00000867-B01

CBL antibody from Abnova Corporation
c-Cbl, CBL2, RNF55

Antibody data

Product number
H00000867-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000867-B01, RRID:AB_1204065
Product name
CBL MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00000867-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CBL protein.
Antigen sequence
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQP
HHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLC
QNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGK
METLGENEYFRVFMENLMKKTKQTISLFKEGKERM
YEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQ
GDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALH
EVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFT
RLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKAR
LQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNIL
QTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLT
GLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICA
ENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNY
DDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQ
ASLPPVPPRLDLLPQRVCVPSSASALGTASKAASG
SLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRP
QRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPI
PKVPVSAPSSSDPWTGRELTNRHSLPFSLPSQMEP
RPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIK
PSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEY
MTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMY
NIQSQAPSITESSTFGEGNLAAAHANTGPEESENE
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSL
DGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQ
KALVIAQNNIEMAKNILREFVSISSPAHVAT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -