H00000867-M01A

CBL antibody from Abnova Corporation
c-Cbl, CBL2, RNF55

Antibody data

Product number
H00000867-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000867-M01A, RRID:AB_1204066
Product name
CBL monoclonal antibody (M01A), clone 6D12
Provider product page
Abnova Corporation - H00000867-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CBL.
Antigen sequence
NIQSQAPSITESSTFGEGNLAAAHANTGPEESENE
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSL
DGDPTTNVTEGSQVPERPPKPFPRRINSER
Isotype
IgG
Antibody clone number
6D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -