Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000867-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000867-M01, RRID:AB_1672304
- Product name
- CBL monoclonal antibody (M01), clone 6D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CBL.
- Antigen sequence
NIQSQAPSITESSTFGEGNLAAAHANTGPEESENE
DDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSL
DGDPTTNVTEGSQVPERPPKPFPRRINSER- Isotype
- IgG
- Antibody clone number
- 6D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CBL monoclonal antibody (M01), clone 6D12 Western Blot analysis of CBL expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CBL expression in transfected 293T cell line by CBL monoclonal antibody (M01), clone 6D12.Lane 1: CBL transfected lysate (Predicted MW: 99.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CBL is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of CBL transfected lysate using anti-CBL monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CBL monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
