HPA027956

CBL antibody from Sigma-Aldrich
c-Cbl, CBL2, RNF55
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027956
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027956, RRID:AB_10601094
Product name
Anti-CBL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027956
Antibody type
Polyclonal
Antigen
Cas-Br-M (murine) ecotropic retroviral transforming sequence recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQG
SGPAASAATASPQLSSEIENLMSQGYSYQDIQKAL
VIAQNNIEMAKNILREFVSISSPAHVA
Storage
-20C
Provider Type Product Number
- No reagents -