HPA028129

CDC27 antibody from Sigma-Aldrich
ANAPC3, APC3, D0S1430E, D17S978E, NUC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028129
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028129, RRID:AB_10603559
Product name
Anti-CDC27 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028129
Antibody type
Polyclonal
Antigen
cell division cycle 27 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQT
HLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDE
EPITQEEQIMG
Storage
-20C
Provider Type Product Number
- No reagents -