Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503514 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Interleukin 1 alpha (IL1A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL1A antibody: synthetic peptide directed towards the N terminal of human IL1A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine
- Host
- Rabbit
- Antigen sequence
VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMV
VVATN GKVLKKRRLS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein.
Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1α, controlling necrosis-induced sterile inflammation.
Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
Wang F, Jiang Z, Li Y, He X, Zhao J, Yang X, Zhu L, Yin Z, Li X, Wang X, Liu W, Shang W, Yang Z, Wang S, Zhen Q, Zhang Z, Yu Y, Zhong H, Ye Q, Huang L, Yuan J
Cellular microbiology 2013 Mar;15(3):474-85
Cellular microbiology 2013 Mar;15(3):474-85
Intracellular interleukin-1 receptor 2 binding prevents cleavage and activity of interleukin-1α, controlling necrosis-induced sterile inflammation.
Zheng Y, Humphry M, Maguire JJ, Bennett MR, Clarke MC
Immunity 2013 Feb 21;38(2):285-95
Immunity 2013 Feb 21;38(2):285-95
Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
Ikeda S, Sasazuki S, Natsukawa S, Shaura K, Koizumi Y, Kasuga Y, Ohnami S, Sakamoto H, Yoshida T, Iwasaki M, Tsugane S
The American journal of gastroenterology 2008 Jun;103(6):1476-87
The American journal of gastroenterology 2008 Jun;103(6):1476-87
No comments: Submit comment
No validations: Submit validation data