ABIN503514

IL1A antibody from antibodies-online
IL-1A, IL1, IL1-ALPHA, IL1F1

Antibody data

Product number
ABIN503514
Provider
antibodies-online
Product name
anti-Interleukin 1 alpha (IL1A) (N-Term) antibody
Provider product page
antibodies-online - ABIN503514
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL1A antibody: synthetic peptide directed towards the N terminal of human IL1A
Description
Affinity Purified
Reactivity
Human, Mouse, Bovine
Host
Rabbit
Antigen sequence
VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMV
VVATN GKVLKKRRLS
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -