HPA025813

XRCC5 antibody from Sigma-Aldrich
KARP-1, KU80, Ku86, KUB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025813
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025813, RRID:AB_1858901
Product name
Anti-XRCC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025813
Antibody type
Polyclonal
Antigen
ATP-dependent DNA helicase 2 subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCF
SVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAV
ALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFP
HIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYA
PTE
Storage
-20C
Provider Type Product Number
- No reagents -