HPA015547

antibody from Atlas Antibodies

Targeting: MORC4 FLJ11565, ZCW4, ZCWCC2

Antibody data

Submit

Validation data

Product number: HPA015547 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015547, RRID:AB_2669216
Product name: Anti-MORC4
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRL QNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDK SSSERSTPPYLFPEYPEASKNTGQNREVSILYPGA KDQRQGSLLPEELEDQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MORC4 protein structure - HPA015547 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-MORC4 antibody. Corresponding MORC4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, placenta and testis using Anti-MORC4 antibody HPA015547 (A) shows similar protein distribution across tissues to independent antibody HPA000395 (B).
Antibody #2 product nr: HPA000395
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta using Anti-MORC4 antibody HPA015547.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MORC4 antibody HPA015547.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MORC4 antibody HPA015547.
Sample type: HUMAN