PAB19967

MORC4 antibody from Abnova Corporation
FLJ11565, ZCW4, ZCWCC2

Antibody data

Product number
PAB19967
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19967, RRID:AB_10961974
Product name
MORC4 polyclonal antibody
Provider product page
Abnova Corporation - PAB19967
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MORC4.
Antigen sequence
PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGV
RDSGAPIQLIPFNREELAERRKAVESWNPVPYSVA
SAAIPAAAIGEKARGYEESEGHNTPKLKNQRELEE
LKRTTEKLERVLAERNLFQQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -