Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023844 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NFATC3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWL
NASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSED
QAAILPGKLELCSDDQGSLSPARETSIDDGLGSQY
PLKKDSCGDQFLSV- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Nfat/calcineurin signaling promotes oligodendrocyte differentiation and myelination by transcription factor network tuning
Epithelial calcineurin controls microbiota-dependent intestinal tumor development
Weider M, Starost L, Groll K, Küspert M, Sock E, Wedel M, Fröb F, Schmitt C, Baroti T, Hartwig A, Hillgärtner S, Piefke S, Fadler T, Ehrlich M, Ehlert C, Stehling M, Albrecht S, Jabali A, Schöler H, Winkler J, Kuhlmann T, Wegner M
Nature Communications 2018;9(1)
Nature Communications 2018;9(1)
Epithelial calcineurin controls microbiota-dependent intestinal tumor development
Peuker K, Muff S, Wang J, Künzel S, Bosse E, Zeissig Y, Luzzi G, Basic M, Strigli A, Ulbricht A, Kaser A, Arlt A, Chavakis T, van den Brink G, Schafmayer C, Egberts J, Becker T, Bianchi M, Bleich A, Röcken C, Hampe J, Schreiber S, Baines J, Blumberg R, Zeissig S
Nature Medicine 2016;22(5):506-515
Nature Medicine 2016;22(5):506-515
No comments: Submit comment
No validations: Submit validation data