HPA023844

NFATC3 antibody from Sigma-Aldrich
NFAT4, NFATX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023844, RRID:AB_1854415
Product name
Anti-NFATC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023844
Antibody type
Polyclonal
Antigen
Nuclear factor of activated T-cells, cytoplasmic 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWL
NASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSED
QAAILPGKLELCSDDQGSLSPARETSIDDGLGSQY
PLKKDSCGDQFLSV
Storage
-20C
Provider Type Product Number
- No reagents -