Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005337-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005337-M02, RRID:AB_1112038
- Product name
- PLD1 monoclonal antibody (M02), clone 10H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLD1.
- Antigen sequence
GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYD
KVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAE
EELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVP
MEVWT- Isotype
- IgG
- Antibody clone number
- 10H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TNF-α- and tumor-induced skeletal muscle atrophy involves sphingolipid metabolism.
De Larichaudy J, Zufferli A, Serra F, Isidori AM, Naro F, Dessalle K, Desgeorges M, Piraud M, Cheillan D, Vidal H, Lefai E, Némoz G
Skeletal muscle 2012 Jan 18;2(1):2
Skeletal muscle 2012 Jan 18;2(1):2
No comments: Submit comment
No validations: Submit validation data