Antibody data
- Product number
- HPA024120
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024120, RRID:AB_1858191
- Product name
- Anti-TOP2B
- Provider product page
- Atlas Antibodies - HPA024120
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKG
KVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADA
SKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGE
EALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGK
PSA
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TOP2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
55af80e3e0991
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein TOP2B is shown in green and the microtubules in red. The image to the left show cells transfected with control siRNA and the image to the right show cells where TOP2B has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:105
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s106
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s107
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s108
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R11441
- Appendix
- 55b0aa429d110.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows moderate nuclear positivity.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in glomeruli and tubules.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans and exocrine glandular cells.
- Sample type
- HUMAN