HPA024120

TOP2B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024120, RRID:AB_1858191
Product name
Anti-TOP2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024120
Antibody type
Polyclonal
Antigen
DNA topoisomerase 2-beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKG
KVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADA
SKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGE
EALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGK
PSA
Storage
-20C
Provider Type Product Number
- No reagents -