Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007189-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007189-M02, RRID:AB_607223
- Product name
- TRAF6 monoclonal antibody (M02), clone 1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRAF6.
- Antigen sequence
TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHE
EIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEAL
RQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRS
TDAGV- Isotype
- IgG
- Antibody clone number
- 1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TRAF6 expression in transfected 293T cell line by TRAF6 monoclonal antibody (M02), clone 1B2.Lane 1: TRAF6 transfected lysate(59.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TRAF6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TRAF4 and TRAF6. HeLa cells were stained with anti-TRAF4 rabbit purified polyclonal 1:1200 and anti-TRAF6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
