Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001395 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001395, RRID:AB_1858377
- Product name
- Anti-TXNRD1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHG
PTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIG
GGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWG
LGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-TXNRD1 antibody. Corresponding TXNRD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells and basal cells in the seminiferous ducts.
- Sample type
- HUMAN