HPA001056

ARNT2 antibody from Sigma-Aldrich
bHLHe1, KIAA0307
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001056
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001056, RRID:AB_1845042
Product name
Anti-ARNT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001056
Antibody type
Polyclonal
Antigen
Aryl hydrocarbon receptor nuclear translocator 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMY
RFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNT
NVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPA
GVHEAGKSVEKADAIFS
Storage
-20C
Provider Type Product Number
- No reagents -