Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004204-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004204-M01, RRID:AB_464107
- Product name
- MECP2 monoclonal antibody (M01), clone 4B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MECP2.
- Antigen sequence
PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGR
SAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSL
DPNDFDFTVTGRGSPSRREQ- Isotype
- IgG
- Antibody clone number
- 4B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MECP2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of MECP2 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody (M01), clone 4B6.Lane 1: MECP2 transfected lysate(52.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in rat muscle.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MECP2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol