Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310486 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Methyl CpG Binding Protein 2 (Rett Syndrome) (MECP2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the N terminal of human MECP2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDK
KEDKE GKHEPLQPSA- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Epigenetic silence of ankyrin-repeat-containing, SH3-domain-containing, and proline-rich-region- containing protein 1 (ASPP1) and ASPP2 genes promotes tumor growth in hepatitis B virus-positive hepatocellular carcinoma.
The association between behavior and genotype in Rett syndrome using the Australian Rett Syndrome Database.
Zhao J, Wu G, Bu F, Lu B, Liang A, Cao L, Tong X, Lu X, Wu M, Guo Y
Hepatology (Baltimore, Md.) 2010 Jan;51(1):142-53
Hepatology (Baltimore, Md.) 2010 Jan;51(1):142-53
The association between behavior and genotype in Rett syndrome using the Australian Rett Syndrome Database.
Robertson L, Hall SE, Jacoby P, Ellaway C, de Klerk N, Leonard H
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2006 Mar 5;141B(2):177-83
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2006 Mar 5;141B(2):177-83
No comments: Submit comment
No validations: Submit validation data