HPA000593

MECP2 antibody from Sigma-Aldrich
MRX16, MRX79, RTT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000593, RRID:AB_1079348
Product name
Anti-MECP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000593
Antibody type
Polyclonal
Antigen
Methyl-CpG-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPG
SVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKT
RETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPG
RKSKESS
Storage
-20C
Provider Type Product Number
- No reagents -