HPA001341

MECP2 antibody from Sigma-Aldrich
MRX16, MRX79, RTT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001341
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001341, RRID:AB_1079347
Product name
Anti-MECP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001341
Antibody type
Polyclonal
Antigen
Methyl-CpG-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDK
KEEKEGKHEPVQPSAHHSAEPAGAGKAETSEGSGS
APAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWT
RKLKQRKSGRSAGKY
Storage
-20C
Provider Type Product Number
- No reagents -