Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32238 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- SMAD Antibody (SMAD1-5)
- Antibody type
- Polyclonal
- Antigen
- Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the SMAD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat heart, 2) mouse heart, 3) rat skeletal muscle, 4) mouse skeletal muscle, 5) 293, 6) MCF7 and 7) HeLa lysate with SMAD antibody. Expected molecular weight of SMADs 1-5: 48~60 kDa, observed here at ~52 kDa.
