Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183694 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMAD1 antibody: synthetic peptide directed towards the C terminal of human SMAD1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKV
LTQMG SPHNPISSVS- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Extracellular matrix-mediated signaling by dentin phosphophoryn involves activation of the Smad pathway independent of bone morphogenetic protein.
Jadlowiec JA, Zhang X, Li J, Campbell PG, Sfeir C
The Journal of biological chemistry 2006 Mar 3;281(9):5341-7
The Journal of biological chemistry 2006 Mar 3;281(9):5341-7
No comments: Submit comment
No validations: Submit validation data