H00000331-M01J

XIAP antibody from Abnova Corporation
API3, BIRC4, hILP, ILP-1
No application information provided.

Antibody data

Product number
H00000331-M01J
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000331-M01J, RRID:AB_1237657
Product name
BIRC4 monoclonal antibody (M01J), clone 2B3
Provider product page
Abnova Corporation - H00000331-M01J
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant BIRC4.
Antigen sequence
GFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRK
VSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDIS
Isotype
IgG
Antibody clone number
2B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -