HPA000164

PABPC5 antibody from Sigma-Aldrich
PABP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000164, RRID:AB_1079551
Product name
Anti-PABPC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000164
Antibody type
Polyclonal
Antigen
Polyadenylate-binding protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEY
GPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVL
DLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLR
L
Storage
-20C
Provider Type Product Number
- No reagents -