Antibody data

Product number
H00001601-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001601-M09, RRID:AB_1574210
Product name
DAB2 monoclonal antibody (M09), clone 3D6
Provider product page
Abnova Corporation - H00001601-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DAB2.
Antigen sequence
MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKT
DEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ
DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKII
DEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG
EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKK
EEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV
DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDT
NQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF
SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLK
SPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI
SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSERE
QNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLA
SDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS
APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSP
SMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP
FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQ
SNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK
DISSDAFTALDPLGDKEIKDVKEMFKDFQLWQPPA
VPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD
DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFE
NPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA
Isotype
IgG
Antibody clone number
3D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -