HPA029590

SLC11A1 antibody from Atlas Antibodies
LSH, NRAMP, NRAMP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029590
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029590, RRID:AB_10794613
Product name
Anti-SLC11A1
Provider product page
Atlas Antibodies - HPA029590
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -