Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006556-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006556-M01, RRID:AB_607029
- Product name
- SLC11A1 monoclonal antibody (M01), clone 2G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC11A1.
- Antigen sequence
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVA
VDIYQGGV- Isotype
- IgG
- Antibody clone number
- 2G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Solute carrier 11A1 is expressed by innate lymphocytes and augments their activation.
Hedges JF, Kimmel E, Snyder DT, Jerome M, Jutila MA
Journal of immunology (Baltimore, Md. : 1950) 2013 Apr 15;190(8):4263-73
Journal of immunology (Baltimore, Md. : 1950) 2013 Apr 15;190(8):4263-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SLC11A1 monoclonal antibody (M01), clone 2G2. Western Blot analysis of SLC11A1 expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SLC11A1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol