Antibody data

Product number
H00006556-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006556-M01, RRID:AB_607029
Product name
SLC11A1 monoclonal antibody (M01), clone 2G2
Provider product page
Abnova Corporation - H00006556-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC11A1.
Antigen sequence
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVA
VDIYQGGV
Isotype
IgG
Antibody clone number
2G2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -