HPA054721

antibody from Atlas Antibodies

Targeting: UMOD

Antibody data

Submit

Validation data

Product number: HPA054721 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA054721, RRID:AB_2682585
Product name: Anti-UMOD
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPAR DGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIK INFACSYP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

UMOD protein structure - HPA054721 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-UMOD antibody. Corresponding UMOD RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-UMOD antibody HPA054721 (A) shows similar protein distribution across tissues to independent antibody HPA043420 (B).
Antibody #2 product nr: HPA043420
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-UMOD antibody HPA054721.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-UMOD antibody HPA054721.
Sample type: HUMAN