HPA027730

ERN1 antibody from Sigma-Aldrich
IRE1, IRE1P
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027730
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027730, RRID:AB_10602494
Product name
Anti-ERN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027730
Antibody type
Polyclonal
Antigen
endoplasmic reticulum to nucleus signaling 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNY
WLLIGHHETPLSASTKMLERFPNNLPKHRENVIPA
DSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAH
APARPEAPVDSMLKDMATIILSTFLLIGWVA
Storage
-20C
Provider Type Product Number
- No reagents -