Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004436-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004436-M02, RRID:AB_581729
- Product name
- MSH2 monoclonal antibody (M02), clone 4B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MSH2.
- Antigen sequence
NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPA
AKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENI
TIKLKQLKAEVIAKNNSFVNEIISRIKVTT- Isotype
- IgG
- Antibody clone number
- 4B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MSH2 expression in transfected 293T cell line by MSH2 monoclonal antibody (M02), clone 4B2.Lane 1: MSH2 transfected lysate (Predicted MW: 104.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MSH2 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAX and MSH2. HeLa cells were stained with anti-MAX rabbit purified polyclonal 1:1200 and anti-MSH2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
