Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502095 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MutS Homolog 2, Colon Cancer, Nonpolyposis Type 1 (E. Coli) (MSH2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMS
ASIGV VGVKMSAVDG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Estrogen receptor alpha gene polymorphism and endometrial cancer risk--a case-control study.
Wedrén S, Lovmar L, Humphreys K, Magnusson C, Melhus H, Syvänen AC, Kindmark A, Landegren U, Fermér ML, Stiger F, Persson I, Baron JA, Weiderpass E
BMC cancer 2008 Nov 6;8:322
BMC cancer 2008 Nov 6;8:322
No comments: Submit comment
No validations: Submit validation data