H00064388-B01P

GREM2 antibody from Abnova Corporation
CKTSF1B2, DAND3, FLJ21195, Prdc

Antibody data

Product number
H00064388-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00064388-B01P, RRID:AB_1237819
Product name
GREM2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00064388-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GREM2 protein.
Antigen sequence
MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYK
DGSSNNSERWQHQIKEVLASSQEALVVTERKYLKS
DWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFY
IPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGL
DPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -