Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021681 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-MSTN
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAV
TFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDC- Isotype
- IgG
- Vial size
- 110µl
- Concentration
- 0.08 mg/ml
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Peroxisome Proliferator-activated Receptor β/δ Induces Myogenesis by Modulating Myostatin Activity
Bonala S, Lokireddy S, Arigela H, Teng S, Wahli W, Sharma M, McFarlane C, Kambadur R
Journal of Biological Chemistry 2012;287(16):12935-12956
Journal of Biological Chemistry 2012;287(16):12935-12956
No comments: Submit comment
No validations: Submit validation data