Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN108525 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Myostatin (MSTN) (AA 267-375) antibody
- Antibody type
- Polyclonal
- Antigen
- The antibody was raised in bovine by immunization with the recombinant Human Myostatin The immunization antigen (16.7 kDa) is a protein containing 152 AA of recombinant Human Myostatin. N-terminal His-tag including the spacer 43 AA (highlighted). The AA sequence of the human myostatin part of the fusion protein is corresponding to the UniProtKB/Swiss-Prot entry O14793, AA267-375
- Description
- Immunoaffinity chromatography on a column with immobilized recombinant Human Myostatin
- Reactivity
- Human
- Host
- Bovine
- Antigen sequence
MRGSHHHHHHGMASMTGGQQ MGRDLYDDDDKDPS
SRSAVRSRRDFGLDCDEHSTESRCCRYPLTVDFEA
FGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLV
HQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYG
KIPAMVVDRCGCS- Epitope
- AA 267-375
- Vial size
- 0.1 mg
- Storage
- The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
Submitted references Myostatin, a transforming growth factor-beta superfamily member, is expressed in heart muscle and is upregulated in cardiomyocytes after infarct.
Organization of the human myostatin gene and expression in healthy men and HIV-infected men with muscle wasting.
Double muscling in cattle due to mutations in the myostatin gene.
Sharma M, Kambadur R, Matthews KG, Somers WG, Devlin GP, Conaglen JV, Fowke PJ, Bass JJ
Journal of cellular physiology 1999 Jul;180(1):1-9
Journal of cellular physiology 1999 Jul;180(1):1-9
Organization of the human myostatin gene and expression in healthy men and HIV-infected men with muscle wasting.
Gonzalez-Cadavid NF, Taylor WE, Yarasheski K, Sinha-Hikim I, Ma K, Ezzat S, Shen R, Lalani R, Asa S, Mamita M, Nair G, Arver S, Bhasin S
Proceedings of the National Academy of Sciences of the United States of America 1998 Dec 8;95(25):14938-43
Proceedings of the National Academy of Sciences of the United States of America 1998 Dec 8;95(25):14938-43
Double muscling in cattle due to mutations in the myostatin gene.
McPherron AC, Lee SJ
Proceedings of the National Academy of Sciences of the United States of America 1997 Nov 11;94(23):12457-61
Proceedings of the National Academy of Sciences of the United States of America 1997 Nov 11;94(23):12457-61
No comments: Submit comment
No validations: Submit validation data