Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010155-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010155-M01, RRID:AB_566247
- Product name
- TRIM28 monoclonal antibody (M01), clone 4E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIM28.
- Antigen sequence
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERP
GTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEG
YGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMR
KVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYN
LIVIER- Isotype
- IgG
- Antibody clone number
- 4E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Multipotent adult germline stem cells and embryonic stem cells functional proteomics revealed an important role of eukaryotic initiation factor 5A (Eif5a) in stem cell differentiation.
Dihazi H, Dihazi GH, Jahn O, Meyer S, Nolte J, Asif AR, Mueller GA, Engel W
Journal of proteome research 2011 Apr 1;10(4):1962-73
Journal of proteome research 2011 Apr 1;10(4):1962-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRIM28 monoclonal antibody (M01), clone 4E6 Western Blot analysis of TRIM28 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M01), clone 4E6.Lane 1: TRIM28 transfected lysate(88.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRIM28 monoclonal antibody (M01), clone 4E6. Western Blot analysis of TRIM28 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRIM28 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol