Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007272-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007272-M01, RRID:AB_464124
- Product name
- TTK monoclonal antibody (M01), clone 3G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TTK.
- Antigen sequence
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDE
LSLNKISADTTDNSGTVNQIMMMANNPEDWLSLLL
KLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQ
NESFARIQVRFAELKAIQEPDDARDYFQMARANCK
KFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAV
P- Isotype
- IgG
- Antibody clone number
- 3G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references High frequency of TTK mutations in microsatellite-unstable colorectal cancer and evaluation of their effect on spindle assembly checkpoint.
Niittymäki I, Gylfe A, Laine L, Laakso M, Lehtonen HJ, Kondelin J, Tolvanen J, Nousiainen K, Pouwels J, Järvinen H, Nuorva K, Mecklin JP, Mäkinen M, Ristimäki A, Ørntoft TF, Hautaniemi S, Karhu A, Kallio MJ, Aaltonen LA
Carcinogenesis 2011 Mar;32(3):305-11
Carcinogenesis 2011 Mar;32(3):305-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TTK monoclonal antibody (M01), clone 3G7 Western Blot analysis of TTK expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TTK monoclonal antibody (M01), clone 3G7. Western Blot analysis of TTK expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TTK expression in transfected 293T cell line by TTK monoclonal antibody (M01), clone 3G7.Lane 1: TTK transfected lysate(97.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TTK is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol