HPA016834

TTK antibody from Sigma-Aldrich
CT96, MPH1, MPS1, MPS1L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016834
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016834, RRID:AB_1858442
Product name
Anti-TTK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016834
Antibody type
Polyclonal
Antigen
Dual specificity protein kinase TTK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEA
LPPDKYGQNESFARIQVRFAELKAIQEPDDARDYF
QMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQ
KAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKN
LSAST
Storage
-20C
Provider Type Product Number
- No reagents -