Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016834 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TTK
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEA
LPPDKYGQNESFARIQVRFAELKAIQEPDDARDYF
QMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQ
KAVERGAVPLEMLEIALRNLNLQKKQLLSEEEKKN
LSAST- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Threonine and tyrosine kinase may serve as a prognostic biomarker for gallbladder cancer
Loss of the Greatwall Kinase Weakens the Spindle Assembly Checkpoint
Xie Y, Lin J, Wang A, Xu W, Long J, Luo Y, Shi J, Liang Z, Sang X, Zhao H
World Journal of Gastroenterology 2017;23(31):5787
World Journal of Gastroenterology 2017;23(31):5787
Loss of the Greatwall Kinase Weakens the Spindle Assembly Checkpoint
Hawley R, Diril M, Bisteau X, Kitagawa M, Caldez M, Wee S, Gunaratne J, Lee S, Kaldis P
PLOS Genetics 2016;12(9):e1006310
PLOS Genetics 2016;12(9):e1006310
No comments: Submit comment
No validations: Submit validation data