Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91117 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91117, RRID:AB_2665807
- Product name
- Anti-LAMA1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAE
GLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQL
MTVLANVTHLLIRANYNSAKMALYRLESVS- Epitope
- Binds to an epitope located within the peptide sequence LVPENFQDFHSKRQI as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3087
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-111, Laminin-121, Laminin-221, Laminin-332, Laminin-411 and Laminin-521.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human testis tissue.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and lymph node tissues using AMAb91117 antibody. Corresponding LAMA1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate immunoreactivity in basement membrane of seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of immunoreactivity in lymphoid tissue (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate positivity in basement membrane of cells in seminiferous ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows no positivity in lymphoid cells as expected.