H00009306-D01P

SOCS6 antibody from Abnova Corporation
CIS4, Cish4, HSPC060, SOCS4, SSI4, STAI4, STATI4

Antibody data

Product number
H00009306-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009306-D01P, RRID:AB_10717447
Product name
SOCS6 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00009306-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human SOCS6 protein.
Antigen sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASD
FGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKS
ESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFS
SSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLR
PTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDF
HDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVP
VVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSS
SPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIF
VDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLP
PMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNS
APGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWY
WGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIV
DLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNP
VSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNK
MKDYLQEKHY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -