ABIN504556

IGF1R antibody from antibodies-online
CD221, IGFIR, IGFR, JTK13, MGC18216
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN504556
Provider
antibodies-online
Product name
anti-Insulin-Like Growth Factor 1 Receptor (IGF1R) (Middle Region) antibody
Provider product page
antibodies-online - ABIN504556
Antibody type
Polyclonal
Antigen
The immunogen for anti-IGF1R antibody: synthetic peptide directed towards the middle region of human IGF1R
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGG
RKNER ALPLPQSSTC
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -