Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504556 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Insulin-Like Growth Factor 1 Receptor (IGF1R) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IGF1R antibody: synthetic peptide directed towards the middle region of human IGF1R
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGG
RKNER ALPLPQSSTC- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading.
Association of a single nucleotide polymorphism in the insulin-like growth factor-1 receptor gene with spinal disc degeneration in postmenopausal Japanese women.
Kubota T, Elalieh HZ, Saless N, Fong C, Wang Y, Babey M, Cheng Z, Bikle DD
Acta astronautica 2013 Nov;92(1):73-78
Acta astronautica 2013 Nov;92(1):73-78
Association of a single nucleotide polymorphism in the insulin-like growth factor-1 receptor gene with spinal disc degeneration in postmenopausal Japanese women.
Urano T, Narusawa K, Shiraki M, Usui T, Sasaki N, Hosoi T, Ouchi Y, Nakamura T, Inoue S
Spine 2008 May 15;33(11):1256-61
Spine 2008 May 15;33(11):1256-61
No comments: Submit comment
No validations: Submit validation data