Antibody data

Product number
H00002056-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002056-M01, RRID:AB_626418
Product name
EPO monoclonal antibody (M01), clone 4G7
Provider product page
Abnova Corporation - H00002056-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EPO.
Antigen sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSL
NENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALL
SEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSL
TTLLRALGAQKEAISPPDAASAAPLRTITADTFRK
LFRVYSNFLRGKLKLYTGEACRTGDR
Isotype
IgG
Antibody clone number
4G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -