HPA027478

GNAS antibody from Sigma-Aldrich
GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6, SgVI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027478
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027478, RRID:AB_10599284
Product name
Anti-GNAS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027478
Antibody type
Polyclonal
Antigen
GNAS complex locus recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFL
VQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQ
MRKEALEK
Storage
-20C
Provider Type Product Number
- No reagents -