HPA028386

GNAS antibody from Sigma-Aldrich
GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6, SgVI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028386
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028386, RRID:AB_10601983
Product name
Anti-GNAS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028386
Antibody type
Polyclonal
Antigen
GNAS complex locus recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAE
EMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLN
PAFREAGAHGSYSPPPE
Storage
-20C
Provider Type Product Number
- No reagents -