Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007021-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007021-A01, RRID:AB_462268
- Product name
- TFAP2B polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TFAP2B.
- Antigen sequence
DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEA
GSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHS
AHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNS
GMNLL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Conditional deletion of activating protein 2alpha (AP-2alpha) in the developing retina demonstrates non-cell-autonomous roles for AP-2alpha in optic cup development.
Bassett EA, Pontoriero GF, Feng W, Marquardt T, Fini ME, Williams T, West-Mays JA
Molecular and cellular biology 2007 Nov;27(21):7497-510
Molecular and cellular biology 2007 Nov;27(21):7497-510
No comments: Submit comment
No validations: Submit validation data