HPA000166

DKC1 antibody from Sigma-Aldrich
Cbf5, DKC, dyskerin, NAP57, NOLA4, XAP101
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000166
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000166, RRID:AB_1078669
Product name
Anti-DKC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000166
Antibody type
Polyclonal
Antigen
H/ACA ribonucleoprotein complex subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMS
EKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLE
KLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYED
GIEVNQEIVVIT
Storage
-20C
Provider Type Product Number
- No reagents -